PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P02440_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 599aa    MW: 67373.2 Da    PI: 6.4072
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P02440_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS150.41.7e-462864281146
                    GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                             l++lL+ c +av+++d + a++lL+++++++s dgd  qRla++f+ +L+arla+++s +y+al +++t+    ++ l+a++l+  +
  GSMUA_Achr10P02440_001 286 LRTLLILCSQAVAADDRRTANELLKQIRQHSSRDGDGSQRLASFFADGLEARLAGTGSLIYHALVAKRTT---ATDILKAYHLYLAA 369
                             5789*************************************************************99999...9************* PP

                    GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTg 146
                             +P+ ++sh+  Nq+Il+  e++++vHiiDf+i  G+QWp+L+q L++R++gpp+lRiT+
  GSMUA_Achr10P02440_001 370 CPFKRVSHFFSNQTILNLSEKASTVHIIDFGIYFGFQWPCLIQRLSTREGGPPKLRITA 428
                             **********************************************************8 PP

2GRAS128.76.5e-40429563184318
                    GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                             +++e++++e+L+++++E+++Vn+ ++  +l+de+v ++s+r++vL+++++++P+v+++   + +++++ F++rf eal ++salfd+
  GSMUA_Achr10P02440_001 429 SKWETIRVEDLHIDKDEVVVVNCLYRFRNLVDETVIVDSPRNRVLNTIRKMNPDVFIHGVVNGSYSAPFFVTRFREALFHFSALFDM 515
                             6899*********************************************************************************** PP

                    GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrer 318
                             le+++pr++e+r  +Er l+gre+ nv+aceg+er+er et+++W+ r
  GSMUA_Achr10P02440_001 516 LETNVPRDDEQRLLIERDLFGREALNVIACEGSERVERPETYKQWQVR 563
                             *********************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098535.994260599IPR005202Transcription factor GRAS
PfamPF035146.0E-44286428IPR005202Transcription factor GRAS
PfamPF035142.2E-37429563IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 599 aa     Download sequence    Send to blast
MVMDSGLHEL FGMMSGLSYD DSHSEQNIFR ALGLGEPQPH LGHSNYAVLP QMSSTTNTSS  60
NPTSTVSTST EGEGLEDGDI FYSDMALRYI SRMLMEEDID EKVSTYKEEL ALRAAEKPFY  120
DILGQKYPPS LGGSSSSSST EEPLANIVVS PSLFIGGMPA WHFKRGVEEA RKFLPSNDKL  180
VINLESNDLS SSREPRSRKN PNSEDLDLAE GRSNKQSAVF GEGELRSEMF DMVLLCQGDK  240
CTQKIFDLRE AMQNIASKND QNGPAKVASS GKARGKKQTK KEVVDLRTLL ILCSQAVAAD  300
DRRTANELLK QIRQHSSRDG DGSQRLASFF ADGLEARLAG TGSLIYHALV AKRTTATDIL  360
KAYHLYLAAC PFKRVSHFFS NQTILNLSEK ASTVHIIDFG IYFGFQWPCL IQRLSTREGG  420
PPKLRITASK WETIRVEDLH IDKDEVVVVN CLYRFRNLVD ETVIVDSPRN RVLNTIRKMN  480
PDVFIHGVVN GSYSAPFFVT RFREALFHFS ALFDMLETNV PRDDEQRLLI ERDLFGREAL  540
NVIACEGSER VERPETYKQW QVRSCYHKDF VIDEDSRWLI QGWKGRIIYA VSAWKPSGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-342905958375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009409514.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809331e-156SCL9_ARATH; Scarecrow-like protein 9
TrEMBLM0RES10.0M0RES1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P02440_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-156GRAS family protein